PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g024786m
Common NameCISIN_1g024786mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family Dof
Protein Properties Length: 263aa    MW: 26513.2 Da    PI: 8.4855
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g024786mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.27.4e-383392261
             zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                       ++++l+cprC+stntkfCyynny+ sqPr+fCk+CrryWt+GG+lr++PvGgg+rkn k+
  orange1.1g024786m 33 EQEQLPCPRCESTNTKFCYYNNYNFSQPRHFCKSCRRYWTHGGTLRDIPVGGGTRKNAKR 92
                       57899***************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-293091IPR003851Zinc finger, Dof-type
PfamPF027014.5E-333591IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.1243791IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103975IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0009751Biological Processresponse to salicylic acid
GO:0042545Biological Processcell wall modification
GO:0045787Biological Processpositive regulation of cell cycle
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MPTDSNENNN NNNNNSSSSS SNKRVTAKNP AAEQEQLPCP RCESTNTKFC YYNNYNFSQP  60
RHFCKSCRRY WTHGGTLRDI PVGGGTRKNA KRCRTIPSST CAATNTMSIT PGVAVGSAHQ  120
DYPLHATPVL VPFQGGSAPL KAANMNGGYG VCGNGTGAGG FASLLSPQGP GFLALGGFGL  180
GLGSGFVGDV GLAGLGRGAW GLAGVSDAGA AAANGGGGGG SSGIGNTWQF ESGEATTTSG  240
FGTADCFSWP DLAISTPGNG LK*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00402DAPTransfer from AT3G50410Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4300141e-48AM430014.2 Vitis vinifera contig VV78X155605.7, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006425808.11e-145hypothetical protein CICLE_v10026061mg
RefseqXP_006466668.11e-145PREDICTED: dof zinc finger protein DOF3.4
TrEMBLA0A067GIA80.0A0A067GIA8_CITSI; Uncharacterized protein
STRINGPOPTR_0007s11790.14e-79(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22862874
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66940.13e-44Dof family protein